SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347372 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347372
Domain Number 1 Region: 512-624
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.28e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00056
Further Details:      
 
Domain Number 2 Region: 328-389,452-497
Classification Level Classification E-value
Superfamily PH domain-like 8.52e-20
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 3 Region: 24-107
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000608
Family G proteins 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000347372
Domain Number - Region: 636-688
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00206
Family Ankyrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347372   Gene: ENSG00000204172   Transcript: ENST00000355232
Sequence length 703
Comment pep:known chromosome:GRCh37:10:47192142:47222824:-1 gene:ENSG00000204172 transcript:ENST00000355232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEDVFSDSGNTGNFDRGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMEMF
EFLNICQAHGFPKILGVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYQDKVGLTHELVQSL
ISTYSTIDAKMASSRVTLLSNSKPLGSEAIDNQGVSLEFDQQQGSVCPSESEIYEAGAED
RMAGAPMAAAVQPAEVTVEVGEDLHMHQVRDREMPEVVEIRRSNCTNHCDLGDTSSYHTK
VSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTPTPVCKLSMRWSNLFT
SEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTY
YSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKSNGLSKDMDTGLGDSI
CFSPGISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWV
QAIQSQILASLQSCKSSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLG
VLMCIECSGIHRSFGTRLSRVRSLELDDWPVELRKVMSSIGNELANSIWEGSSQGQTKPS
IKSTREEKEWWIRSKYEEKLFLAPLPCTELSLGQQLLRATTDEDLQTAILLLAHGSREEV
NETCGEGDGCTALHLACRKGNVVLEQLLTGWTSWPEMPTGTQR
Download sequence
Identical sequences ENSP00000347372 ENSP00000407436 9606.ENSP00000407436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]