SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347928 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347928
Domain Number 1 Region: 291-344
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000486
Family UBA domain 0.013
Further Details:      
 
Domain Number 2 Region: 14-193
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000916
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347928   Gene: ENSG00000134882   Transcript: ENST00000355700
Sequence length 344
Comment pep:novel chromosome:GRCh37:13:99853028:100037569:1 gene:ENSG00000134882 transcript:ENST00000355700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGI
TAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLD
IQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAA
PPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences A0A024RE02 G2HEI7 Q8NBM4
ENSPTRP00000053400 NP_001137544.1.87134 NP_001137544.1.92137 NP_001233420.1.37143 gi|221316645|ref|NP_001137544.1| ENSP00000383911 9598.ENSPTRP00000053400 9606.ENSP00000383911 ENSPTRP00000053400 ENSP00000347928 ENSP00000383911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]