SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348501 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348501
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000272
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348501   Gene: ENSG00000189164   Transcript: ENST00000356178
Sequence length 609
Comment pep:known chromosome:GRCh37:19:37862083:37883968:1 gene:ENSG00000189164 transcript:ENST00000356178 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVGLCKAMSQGLVTFRDVALDFSQEEWEWLKPSQKDLYRDVMLENYRNLVWLGLSISKP
NMISLLEQGKEPWMVERKMSQGHCADWESWCEIEELSPKWFIDEDEISQEMVMERLASHG
LECSSFREAWKYKGEFELHQGNAERHFMQVTAVKEISTGKRDNEFSNSGRSIPLKSVFLT
QQKVPTIQQVHKFDIYDKLFPQNSVIIEYKRLHAEKESLIGNECEEFNQSTYLSKDIGIP
PGEKPYESHDFSKLLSFHSLFTQHQTTHFGKLPHGYDECGDAFSCYSFFTQPQRIHSGEK
PYACNDCGKAFSHDFFLSEHQRTHIGEKPYECKECNKAFRQSAHLAQHQRIHTGEKPFAC
NECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCG
KAFSRRIALTLHQRIHTGEKPFKCSECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFR
TDSQLNRHHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSY
LNQHQRIHTGEKPYECSECGKAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRH
QRIHNRETL
Download sequence
Identical sequences Q8NB42
ENSP00000348501 ENSP00000390179 ENSP00000390179 NP_115829.1.87134 NP_115829.1.92137 9606.ENSP00000348501 gi|149192841|ref|NP_115829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]