SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348696 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348696
Domain Number 1 Region: 261-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-85
Family Protein kinases, catalytic subunit 0.000000000267
Further Details:      
 
Weak hits

Sequence:  ENSP00000348696
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0458
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348696   Gene: ENSG00000149269   Transcript: ENST00000356341
Sequence length 553
Comment pep:known chromosome:GRCh37:11:77032752:77185107:-1 gene:ENSG00000149269 transcript:ENST00000356341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDC
QAPLQPHSTDCCS
Download sequence
Identical sequences H2Q4G3
9606.ENSP00000278568 NP_001122092.1.87134 NP_001122092.1.92137 XP_008958498.1.60992 XP_011543382.1.92137 XP_011543383.1.92137 XP_011543384.1.92137 XP_011543385.1.92137 XP_011543386.1.92137 XP_016777177.1.37143 gi|190886457|ref|NP_001122092.1| ENSP00000278568 ENSP00000278568 ENSP00000348696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]