SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000348827 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348827
Domain Number 1 Region: 230-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-71
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 120-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-28
Family Nuclear receptor 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348827   Gene: ENSG00000151090   Transcript: ENST00000356447
Sequence length 476
Comment pep:known chromosome:GRCh37:3:24159705:24536313:-1 gene:ENSG00000151090 transcript:ENST00000356447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYCMQEIYEVHPAAGSNCYMQSTDYYAYFEDSPGYSGCDAQAVPSNNIYMEQAWAVNQP
YTCSYPGNMFKSKDSDLDMALNQYSQPEYFTEEKPTFSQVQSPSYSQKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECR
FKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTV
TEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVD
FAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGG
LGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEH
YINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences A0A2I3FV35 A0A2I3NB61 A0A2I3SVN9 A0A2J8WZ40 A0A2K5ENR9 A0A2K5MKR8 A0A2K5PHH4 A0A2K5YHL0 A0A2K6E1L8 A0A2K6JUK5 A0A2K6NWI9 G3QWF5 G7MJY3 G7NY92
ENSP00000348827 ENSP00000280696 XP_008007482.1.81039 XP_008949882.1.60992 XP_008982157.1.60252 XP_009443300.1.37143 XP_010355618.1.97406 XP_011751742.1.29376 XP_011830186.1.47321 XP_011899240.1.92194 XP_012290934.1.9421 XP_012354714.1.23891 XP_014987767.1.72884 XP_015299981.1.63531 XP_017361717.1.71028 XP_017748904.1.44346 XP_018878712.1.27298 ENSP00000280696 9598.ENSPTRP00000025350 ENSGGOP00000007113 ENSGGOP00000007113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]