SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349882 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349882
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 336-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000971
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 435-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000759
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000292
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 269-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000573
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349882   Gene: ENSG00000198105   Transcript: ENST00000357328
Sequence length 579
Comment pep:known chromosome:GRCh37:10:38120463:38147012:-1 gene:ENSG00000198105 transcript:ENST00000357328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKI
EQGEEPWILEKGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKTVSVENGDRGS
KTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRH
EKIPIGEKSYKYDQKRNAINYHQDLSQPSFGQSFEYSKNGQGFHDEAAFFTNKRSQIGET
VCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFGHQRALTKDNPYEYN
EYGEIFCDNSAFIIHQGAYTRKILREYKVSDKTWEKSALLKHQIVHMGGKSYDYNENGSN
FSKKSHLTQLRRAHTGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK
PHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALT
VHQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQR
THTGEKPYECNACGKTFSQRSVLTKHQRIHTRVKALSTS
Download sequence
Identical sequences A2RUI7 Q8NDW4
gi|32698748|ref|NP_066383.1| ENSP00000349882 ENSP00000379208 NP_001254526.1.87134 NP_001254526.1.92137 NP_066383.1.87134 NP_066383.1.92137 XP_006717548.1.92137 XP_011517899.1.92137 XP_016871934.1.92137 XP_016871935.1.92137 9606.ENSP00000379208 ENSP00000349882 ENSP00000379208 ENSP00000349882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]