SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350295 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350295
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 17-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 213-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000556
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350295   Gene: ENSG00000180257   Transcript: ENST00000357666
Sequence length 651
Comment pep:known chromosome:GRCh37:19:53452632:53466114:-1 gene:ENSG00000180257 transcript:ENST00000357666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLREEATKKSKEKEPGMALPQGRLTFRDVAIEFSLEEWKCLNPAQRALYRAVMLENYRNL
EFVDSSLKSMMEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV
ERNGHEAPMTKIKKLTGSTDRSDHRHAGNKPIKDQLGLSFHSHLPELHMFQTKGKISNQL
DKSIGASSASESQRISCRLKTHISNKYGKNFLHSSFTQIQEICMREKPCQSNECGKAFNY
SSLLRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSL
VCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHK
AIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHT
GEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKP
YTCNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCK
VCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQRVHTGEKPYKCNECGK
VFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHHQAIHGCRETLQM
Download sequence
Identical sequences A0A024R4J0 Q0VGE8
ENSP00000350295 ENSP00000403266 ENSP00000350295 ENSP00000350295 ENSP00000403266 ENSP00000480082 NP_001026835.1.87134 NP_001026835.1.92137 NP_001189385.1.87134 NP_001189385.1.92137 NP_001189386.1.87134 NP_001189386.1.92137 gi|320461554|ref|NP_001189385.1| gi|320461556|ref|NP_001189386.1| gi|72384365|ref|NP_001026835.1| 9606.ENSP00000350295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]