SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000350418 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350418
Domain Number 1 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-25
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.26e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 498-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 162-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350418   Gene: ENSG00000197360   Transcript: ENST00000357774
Sequence length 572
Comment pep:known chromosome:GRCh37:19:22573899:22605148:-1 gene:ENSG00000197360 transcript:ENST00000357774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPLGSLEMGVLTFRDVALEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFVGIAASKPD
LITCLEQGKEPWNVKRHEMVTEPPVVYSYFAQDLWPKQGKKNYFQKVILRTYKKCGRENL
QLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQYDKYVKVFHKFSNSNRHKIGHTGKK
SFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKC
EECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECG
RAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFS
RLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEVCSKAFSRFSH
LTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKH
KVIHTGEKPYKCEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSSILNRHKMIH
TGEKLYKPESCNNACDNIAKISKYKRNCAGEK
Download sequence
Identical sequences A6NK75
ENSP00000350418 9606.ENSP00000350418 gi|148806912|ref|NP_001092096.1| ENSP00000350418 NP_001092096.1.87134 NP_001092096.1.92137 ENSP00000350418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]