SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000351324 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351324
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000342
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 340-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000133
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 8 Region: 256-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000499
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 461-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000129
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351324   Gene: ENSG00000197124   Transcript: ENST00000358523
Sequence length 498
Comment pep:known chromosome:GRCh37:19:20116476:20150014:-1 gene:ENSG00000197124 transcript:ENST00000358523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLTFRDVTIEFSLEEWEFLNPAQQSLYRKVMLENYRNLVSLGLTVSKPELISRLEQRQ
EPWNVKRHETIAKPPAMSSHYTEDLLPEQCMQDSFQKVILRRYGSCGLEDLHLRKDGENV
GECKDQKEIYNGLNQCLSTLPSKIFPYNKCVKVFSKSSNLNRENIRHTTEKLFKCMQCGK
VFKSHSGLSYHKIIHTEEKLCICEECGKTFKWFSYLTKHKRIHTGEKPYKCEECGKAFNW
CSSLTKHKRIHTGEKPYKCEECGKAFHWCSPFVRHKKIHTGEKPYTCEDCGRAFNRHSHL
TKHKTIHTGKKPYKCKECGKAFNHCSLLTIHERTHTGEKPYKCEECGKAFNSSSILTEHK
VIHSGEKPYKCEKCDKVFKRFSYLTKHKRIHTGEKPYKCEECGKAFNWSSILTEHKRIHT
GEKPYNCEECGKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS
CKYKKCGEAFNHCSNLTT
Download sequence
Identical sequences O95780
gi|15150801|ref|NP_149973.1| ENSP00000380351 ENSP00000380351 ENSP00000351324 NP_149973.1.87134 NP_149973.1.92137 9606.ENSP00000380351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]