SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352836 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352836
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.16e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000337
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352836   Gene: ENSG00000197372   Transcript: ENST00000359788
Sequence length 568
Comment pep:known chromosome:GRCh37:19:23835708:23870017:-1 gene:ENSG00000197372 transcript:ENST00000359788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK
EPLTVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD
ECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRS
FCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQF
SNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN
IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG
EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY
KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER
CDKAFNQSANLTKHKKIHTGEKLQNWNV
Download sequence
Identical sequences Q8TD23
ENSP00000352836 ENSP00000352836 gi|110578653|ref|NP_612203.2| ENSP00000352836 NP_612203.2.87134 NP_612203.2.92137 9606.ENSP00000352836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]