SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000353058 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353058
Domain Number 1 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-23
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.7e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 418-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353058   Gene: ENSG00000197363   Transcript: ENST00000359971
Sequence length 492
Comment pep:known chromosome:GRCh37:8:146024261:146034529:1 gene:ENSG00000197363 transcript:ENST00000359971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMALPMPGPQEAVVFEDVAVYFTRIEWSCLAPDQQALYRDVMLENYGNLASLGFLVAKP
ALISLLEQGEEPGALILQVAEQSVAKASLCTDSRMEAGIMESPLQRKLSRQAGLPGTVWG
CLPWGHPVGGHPAPPHPHGGPEDGSDKPTHPRAREHSASPRVLQEDLGRPVGSSAPRYRC
VCGKAFRYNSLLLRHQIIHTGAKPFQCTECGKAFKQSSILLRHQLIHTEEKPFQCGECGK
AFRQSTQLAAHHRVHTRERPYACGECGKAFSRSSRLLQHQKFHTGEKPFACTECGKAFCR
RFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGVGQGALLGAAQR
PQAGDPPHECPVCGRPFRHNSLLLLHLRLHTGEKPFECAECGKAFGRKSNLTLHQKIHTK
EKPFACTECGKAFRRSYTLNEHYRLHSGERPYRCRACGRACSRLSTLIQHQKVHGREPGE
DTEGRRAPCWAS
Download sequence
Identical sequences Q6ZMY9
ENSP00000353058 ENSP00000353058 ENSP00000435166 ENSP00000436103 ENSP00000353058 ENSP00000435166 ENSP00000436103 NP_998770.2.87134 NP_998770.2.92137 XP_011515316.1.92137 XP_011515317.1.92137 9606.ENSP00000353058 gi|125490356|ref|NP_998770.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]