SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355396 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355396
Domain Number 1 Region: 96-483
Classification Level Classification E-value
Superfamily L domain-like 1.14e-62
Family Internalin LRR domain 0.075
Further Details:      
 
Domain Number 2 Region: 689-784
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 604-700
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-20
Family I set domains 0.0093
Further Details:      
 
Domain Number 4 Region: 497-606
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-18
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  ENSP00000355396
Domain Number - Region: 46-114
Classification Level Classification E-value
Superfamily L domain-like 0.0748
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355396   Gene: ENSG00000198799   Transcript: ENST00000361127
Sequence length 1065
Comment pep:known chromosome:GRCh37:1:113615831:113667824:1 gene:ENSG00000198799 transcript:ENST00000361127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPLGVPEEQLLGCRSRVLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDFSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRMSMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNN
AIMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQ
SILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEIL
YDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNE
MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIY
LNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRV
ICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESL
IPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESP
QLHQNEGLAGREPDCSASSMSCHRLQDHAFDFSRTRNIQDGSEGT
Download sequence
Identical sequences O94898
9606.ENSP00000355396 ENSP00000355396 ENSP00000355396 ENSP00000355396 NYSGRC-IgSF-LRIG2_HUMAN NP_055628.1.87134 NP_055628.1.92137 gi|7662320|ref|NP_055628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]