SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000355460 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355460
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.73e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 249-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 198-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000118
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 153-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000421
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355460   Gene: ENSG00000197472   Transcript: ENST00000366504
Sequence length 515
Comment pep:known chromosome:GRCh37:1:247108851:247171301:-1 gene:ENSG00000197472 transcript:ENST00000366504 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGLLAFRDVALEFSPEEWECLDPAQRSLYRDVMLENYRNLISLGEDSFNMQFLFHSLAMS
KPELIICLEARKEPWNVNTEKTARHSVLSSYLTEDILPEQGLQVSFQKVMLRRYERCCLE
KLRLRNDWEIVGEWKGQKASYNGLDLCSATTHSKNFQCNKCVKGFSKFANLNKCKISHTG
EKPFKCKECGNVSCMSLIMTQQQRIHIGENPYQCKKCGKAFNECSCFTDCKRIHVGEKHC
KCEECNNIFKSCSSLAVVEKNHTEKKTYRCEECGKAFNLCSVLTKHKKIHTGEKPYKCEE
CGKSFKLFPYLTQHKRIHSREKPYKCEECGKVFKLLSYLTQHRRIHTGEKTFRCEECGKA
FNQSSHLTEHRRIHTGEKPYKCEECGKAFTWFSYLIQHKRIHTGQKPYKCEECGKAFTWF
SYLTQHKRIHTGEKPYKCDECGKAFNWFSYLTNHKRIHTGEKPYKCEECGKAFGQSSHLS
KHKTIHTREKPYKCEECGKAFNHSAQLAVHEKTHT
Download sequence
Identical sequences Q8IW36
ENSP00000341236 9606.ENSP00000341236 ENSP00000341236 ENSP00000355460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]