SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357356 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357356
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-24
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 3 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 471-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 280-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000524
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSP00000357356
Domain Number - Region: 137-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000181
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357356   Gene: ENSG00000229631   Transcript: ENST00000368372
Sequence length 526
Comment pep:known supercontig:GRCh37:GL000223.1:149787:180454:1 gene:ENSG00000229631 transcript:ENST00000368372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFLEVWLDNPKMWLRDNQ
DNLKSMERGHKYDVFGKIFNSSINIVHVGLRSHKCGTGEKSLKCPFDLLIPKNNCERKKI
DELNKKLLFCIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRFFNK
KSQLVIHQRTHTGEKPYQCSECGKAFSQKSLLTVHQRTHSGEKPHGCSECQKAFSRKSLL
ILHQRIHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQ
RAHTGEKPYPCSHCGKAFFWKSQLITHQRTHTGKKPYGCGECQKAFSRNSLLIRHQRIHT
GEKPYECNECGEAFIRKPQLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP
YGCIQCGKTFFGKSQLLTHHRTHTGEKPYECSECGKAFTQKSSLISHQRTHTGEKPYECS
ECRKTFSEKSSLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRI
Download sequence
Identical sequences ENSP00000357356 ENSP00000357356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]