SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357908 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357908
Domain Number 1 Region: 37-522
Classification Level Classification E-value
Superfamily Sema domain 1.31e-136
Family Sema domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 518-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000157
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357908   Gene: ENSG00000143434   Transcript: ENST00000368912
Sequence length 962
Comment pep:known chromosome:GRCh37:1:151104161:151118933:-1 gene:ENSG00000143434 transcript:ENST00000368912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELG
LDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAI
FAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVQALEHGDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPVTHQPLLTLTSR
ALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLTPGGRSGGPEPILLEEIDAYSPARCS
GKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRCARHGACQRSCLASQDPYCGWH
SSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYVLPGPGPSPGTPSP
PSDAHPRPQSSTLGVHTRGVRRDLPPASASRSVPIPLLLASVAAAFALGASVSGLLVSCA
CRRAHRRRGKDIETPGLPRPLSLRSLARLHGGGPEPPPPSKDGDAVQTPQLYTTFLPPPE
GVPPPELACLPTPESTPELPVKHLRAAGDPWEWNQNRNNAKEGPGRSRGGHAAGGPAPRV
LVRPPPPGCPGQAVEVTTLEELLRYLHGPQPPRKGAEPPAPLTSRALPPEPAPALLGGPS
PRPHECASPLRLDVPPEGRCASAPARPALSAPAPRLGVGGGRRLPFSGHRAPPALLTRVP
SGGPSRYSGGPGKHLLYLGRPEGYRGRALKRVDVEKPQLSLKPPLVGPSSRQAVPNGGRF
NF
Download sequence
Identical sequences ENSP00000357908 NP_001171532.1.87134 NP_001171532.1.92137 XP_005244892.1.92137 XP_016855564.1.92137 XP_016855565.1.92137 XP_016855566.1.92137 gi|295849299|ref|NP_001171532.1| ENSP00000357909 ENSP00000357909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]