SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357982 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357982
Domain Number 1 Region: 121-418
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-59
Family Nuclear receptor ligand-binding domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 50-136
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357982   Gene: ENSG00000112333   Transcript: ENST00000368986
Sequence length 422
Comment pep:known chromosome:GRCh37:6:108487262:108510013:1 gene:ENSG00000112333 transcript:ENST00000368986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRAGAEGAEKEPSPRPECRADPGPGLGFPLGSGLPWPSLLESPGGRILDIPCKVCGDRS
SGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNM
NKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLE
LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSV
PAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIIS
EIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQL
TLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSS
DI
Download sequence
Identical sequences A0A2I3S7T8 G3R3I4
ENSGGOP00000009811 ENSGGOP00000020083 ENSGGOP00000009811 ENSGGOP00000020083 NP_001273031.1.87134 NP_001273031.1.92137 XP_009450061.1.37143 XP_016800524.1.37143 9598.ENSPTRP00000049756 ENSP00000357979 ENSP00000357982 ENSP00000357979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]