SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360165 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360165
Domain Number 1 Region: 151-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.93e-74
Family Actin/HSP70 0.000000691
Further Details:      
 
Domain Number 2 Region: 8-156
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.1e-47
Family Actin/HSP70 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360165   Gene: ENSG00000123165   Transcript: ENST00000371124
Sequence length 376
Comment pep:known chromosome:GRCh37:X:127184943:127186382:-1 gene:ENSG00000123165 transcript:ENST00000371124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQE
ALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIRE
KLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTK
LCMAGRDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGA
YRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVL
SGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTS
ADFKEYGTSVVQRRCF
Download sequence
Identical sequences Q8TDG2
ENSP00000360165 9606.ENSP00000360165 ENSP00000360165 ENSP00000360165 NP_612146.1.87134 NP_612146.1.92137 gi|19923076|ref|NP_612146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]