SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362446 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362446
Domain Number 1 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 439-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000314
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 8 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000019
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362446   Gene: ENSG00000196152   Transcript: ENST00000342483
Sequence length 498
Comment pep:known chromosome:GRCh37:9:130186661:130207651:1 gene:ENSG00000196152 transcript:ENST00000342483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQERWRCLVSTPR
DRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPE
QALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETHTESFK
NSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ
RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHT
GEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKP
YRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCN
ECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGK
AFRCSSAFVRHQRLHAGE
Download sequence
Identical sequences Q15937
ENSP00000362446 9606.ENSP00000362446 ENSP00000362446 NP_009066.2.87134 NP_009066.2.92137 gi|188528633|ref|NP_009066.2| ENSP00000362446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]