SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362684 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000362684
Domain Number - Region: 35-108
Classification Level Classification E-value
Superfamily STAT 0.00388
Family STAT 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362684   Gene: ENSG00000183615   Transcript: ENST00000373582
Sequence length 163
Comment pep:known chromosome:GRCh37:1:32712834:32714457:1 gene:ENSG00000183615 transcript:ENST00000373582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQA
KPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQLLRLRAQLHRLKMDQACHLH
QELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC
Download sequence
Identical sequences G3S571 H2PYK2 Q9BTA0
NYSGRC-110238585 NP_116037.2.87134 NP_116037.2.92137 XP_001161749.1.37143 XP_003828197.1.60992 XP_004025415.1.27298 9598.ENSPTRP00000000839 9606.ENSP00000362684 ENSP00000362684 ENSP00000362684 gi|110238585|ref|NP_116037.2| ENSGGOP00000023227 ENSPTRP00000000839 ENSGGOP00000023227 ENSPTRP00000000839 ENSP00000362684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]