SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365289 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365289
Domain Number 1 Region: 161-239,277-404
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000726
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365289   Gene: ENSG00000204488   Transcript: ENST00000376121
Sequence length 474
Comment pep:known chromosome:GRCh37:1:13495254:13498260:1 gene:ENSG00000204488 transcript:ENST00000376121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQSPSRLLELAGQSLLRNQFLTIFILDELPREVFPLMFMEASSMRHFEALKLMVQAWP
FLRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDGNFWTIWSGAR
ALSCSPEAMRKRQTVEDYPRTGEHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRGLVHL
CCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFLA
FGYDDELYVSGQQQFVPDLDCPFLCLYYPQMLYIRKISNIKEHLEHLLRCLKNPLGTFIF
CHAYLADQDMECLSQYPSLSQLKELHLIHILMWTTNLEPLGALLEKVAATLEILTLKDCQ
IQDSQLRVLLPALSRCSQLTTFYFRGNETSTNALKDLLCHTGGLSKLGLELYPAPLECLD
NRGHVNWEILAPIRAELMCTLREVRQPKRIFFGPIPCPSCGSWPSEKVDFHLCS
Download sequence
Identical sequences ENSP00000365289 9606.ENSP00000365289 ENSP00000365289 gi|113865933|ref|NP_001038945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]