SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366142 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366142
Domain Number 1 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 23-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 566-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 204-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000146
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366142   Gene: ENSG00000147118   Transcript: ENST00000376943
Sequence length 639
Comment pep:novel chromosome:GRCh37:X:47834250:47863354:-1 gene:ENSG00000147118 transcript:ENST00000376943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPASASGEDSGSFYSWQKAKREQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETY
SNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQ
VGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAE
NKYDNGCAKLFFHTEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACR
KTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFR
EKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLD
LIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVH
QRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGH
TGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEK
PYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKC
TECGKAFTQKSNLIVHQRTHAGKKAHGRGHTRKSKFMAH
Download sequence
Identical sequences P17025
NP_001171570.1.87134 NP_001171570.1.92137 NP_008893.1.87134 NP_008893.1.92137 ENSP00000306351 ENSP00000380165 ENSP00000470287 ENSP00000471026 gi|296010923|ref|NP_001171570.1| gi|55769559|ref|NP_008893.1| ENSP00000366142 ENSP00000306351 ENSP00000380165 9606.ENSP00000306351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]