SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000369976 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369976
Domain Number 1 Region: 400-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-26
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 138-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 94-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSP00000369976
Domain Number - Region: 60-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369976   Gene: ENSG00000198759   Transcript: ENST00000380602
Sequence length 554
Comment pep:known chromosome:GRCh37:X:13587741:13651694:1 gene:ENSG00000198759 transcript:ENST00000380602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMINCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKAKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKADLNISVDCSFNHGICDWKQDREDDF
DWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLR
VFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLL
VSGLCPDSLLSVDD
Download sequence
Identical sequences ENSP00000369976 NP_001161362.1.87134 NP_001161362.1.92137 gi|268607667|ref|NP_001161362.1| ENSP00000369976 ENSP00000369976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]