SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369981 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369981
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-79
Family BAR domain 0.00000000133
Further Details:      
 
Domain Number 2 Region: 284-347
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369981   Gene: ENSG00000107295   Transcript: ENST00000380607
Sequence length 352
Comment pep:known chromosome:GRCh37:9:17579121:17797127:1 gene:ENSG00000107295 transcript:ENST00000380607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Download sequence
Identical sequences A0A2I2Y4S8 A0A2I3HW13 A0A2I3SZG1 A0A2J8XI81 F7IB79 Q99962
NP_003017.1.87134 NP_003017.1.92137 XP_003260449.1.23891 XP_018889592.1.27298 XP_021530995.1.9421 XP_520501.3.37143 ENSCJAP00000023293 ENSPTRP00000035569 ENSGGOP00000007517 9598.ENSPTRP00000035569 9606.ENSP00000369981 hso002002785.1 gi|4506931|ref|NP_003017.1| ENSGGOP00000007517 ENSCJAP00000023303 ENSP00000369981 ENSPTRP00000035569 ENSP00000369981 ENSP00000369981 ENSNLEP00000021325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]