SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371514 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371514
Domain Number 1 Region: 261-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-54
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 99-210
Classification Level Classification E-value
Superfamily POZ domain 1.2e-25
Family Tetramerization domain of potassium channels 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371514   Gene: ENSG00000168263   Transcript: ENST00000382082
Sequence length 545
Comment pep:known chromosome:GRCh37:9:2717502:2730037:1 gene:ENSG00000168263 transcript:ENST00000382082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQSERRRSWSYRPWNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDED
GEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELAGFPK
TRLGRLATSTSRSRQLSLCDDYEEQTDEYFFDRDPAVFQLVYNFYLSGVLLVLDGLCPRR
FLEELGYWGVRLKYTPRCCRICFEERRDELSERLKIQHELRAQAQVEEAEELFRDMRFYG
PQRRRLWNLMEKPFSSVAAKAIGVASSTFVLVSVVALALNTVEEMQQHSGQGEGGPDLRP
ILEHVEMLCMGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQLLLECFTGEGH
QRGQTVGSVGKVGQVLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAM
GIFTFSAAVYSVEHDVPSTNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAF
GIILNGMPISILYNKFSDYYSKLKAYEYTTIRRERGEVNFMQRARKKIAECLLGSNPQLT
PRQEN
Download sequence
Identical sequences Q8TDN2
9606.ENSP00000371514 ENSP00000371514 NP_598004.1.87134 NP_598004.1.92137 ENSP00000371514 gi|19424136|ref|NP_598004.1| ENSP00000371514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]