SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371960 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371960
Domain Number 1 Region: 160-308
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-29
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000598
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371960   Gene: ENSG00000185187   Transcript: ENST00000382520
Sequence length 504
Comment pep:known chromosome:GRCh37:11:405903:417325:-1 gene:ENSG00000185187 transcript:ENST00000382520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGG
HYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVA
AVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKF
VNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSH
SFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
KEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGMPA
QPHSPTGEAQHRAEWGQAQGTGPGGAPGVEDSSRHREPLHGLCPGGARPSVCLGTSWASQ
AITAGGEQGQPLAVGLGQGCGWPPQASRSPHPRCPGACLWRAISSTAHQWGLAGREPEQR
SGRLGSRLAKLQCPHRLLLPGVQG
Download sequence
Identical sequences C9JFX4
ENSP00000433022 XP_005253101.1.92137 XP_005253102.1.92137 XP_005253103.1.92137 ENSP00000371960 ENSP00000371960 ENSP00000433022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]