SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000372704 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372704
Domain Number 1 Region: 255-531
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-77
Family Nuclear receptor ligand-binding domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSP00000372704
Domain Number - Region: 176-216
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 119-128
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372704   Gene: ENSG00000206289   Transcript: ENST00000383217
Sequence length 537
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_QBL:33090190:33097291:-1 gene:ENSG00000206289 transcript:ENST00000383217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRS
LSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCK
QKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences A0A0S2Z570 A0A2K5LC27 A0A2K5WBN9 A0A2K5Y943 A0A2K6CBP5 H2QSS5
NP_001257330.1.87134 NP_001257330.1.92137 XP_005553390.1.63531 XP_008958903.1.60992 XP_009449278.1.37143 XP_011727379.1.29376 XP_011832047.1.47321 XP_011932198.1.92194 ENSPTRP00000030802 ENSP00000363817 ENSP00000372703 ENSP00000393286 ENSP00000393870 ENSP00000400104 ENSP00000402590 9598.ENSPTRP00000030802 9606.ENSP00000372703 9606.ENSP00000393286 9606.ENSP00000393870 9606.ENSP00000400104 9606.ENSP00000402590 ENSP00000363817 ENSP00000372703 ENSP00000393286 ENSP00000393870 ENSP00000400104 ENSP00000402590 ENSP00000363817 ENSP00000372704 ENSP00000402506 ENSP00000402590 ENSP00000406246 ENSP00000410433 ENSPTRP00000030802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]