SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373274 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373274
Domain Number 1 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 17-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 201-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000474
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373274   Gene: ENSG00000197385   Transcript: ENST00000360311
Sequence length 632
Comment pep:known chromosome:GRCh37:3:32023266:32033120:1 gene:ENSG00000197385 transcript:ENST00000360311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLREEAAQKRKEKEPGMALPQGHLTFRDVAIEFSLEEWKCLDPTQRALYRAMMLENYRNL
HSVDISSKCMMKKFSSTAQGNTEVDTGTLERHESHHIGDFCFQKIGKDIHDFEFQWQEDK
RNSHEATMTQIKKLTGSTDRYDRRHPGNKPIKDQLGLSFHSHLPELHIFQTKGKVGNQVE
KSINDASSVLTSQRISSRPKIHISNNYENNFFHSSLLTLKQEVHIREKSFQCNESGKAFN
CSSLLRKHQIIYLGGKQYKCDVCGKVFNQKRYLACHHRCHTGEKPYKCNECGKVFNQQSN
LASHHRLHTGEKPYKCEECDKVFSRKSNLERHRRIHTGEKPYKCKVCEKAFRRDSHLTQH
TRIHTGEKPYKCNECGKAFSGQSTLIHHQAIHGIGKLYKCNDCHKVFSNATTIANHWRIH
NEERSYKCNKCGKFFRRRSYLVVHWRTHTGEKPYKCNECGKTFHHNSALVIHKAIHTGEK
PYKCNECGKTFRHNSALVIHKAIHTGEKPYKCNECGKVFNQQATLARHHRLHTGEKPYKC
EECDTVFSRKSHHETHKRIHTGEKPYKCDDFDEAFSQASSYAKQRRIHMGEKHHKCDDCG
KAFTSHSHRIRHQRIHTGQKSYKCHKRGKVFS
Download sequence
Identical sequences A6NHJ4
NP_001131146.2.87134 NP_001131146.2.92137 XP_016861788.1.92137 ENSP00000373274 ENSP00000373274 ENSP00000373274 9606.ENSP00000373274 gi|332801011|ref|NP_001131146.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]