SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374252 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374252
Domain Number 1 Region: 55-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.37e-54
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 248-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.22e-31
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 3 Region: 525-576
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000706
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374252   Gene: ENSG00000239388   Transcript: ENST00000389601
Sequence length 587
Comment pep:known chromosome:GRCh37:3:57302379:57326710:-1 gene:ENSG00000239388 transcript:ENST00000389601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESLHSFLSADYKKIVETIEKG
KEDALSHLTKYHSAFGEADEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGETP
LFLAVSSCLLENATFLLLNGCNPNAKNFEGNSPLLAAVLRDCYDMAALLINYGADVNLRC
ANERTALHEAAKLGREDMVKLMLVSGAHPDPQSTYGFTPLALAAQSGHTEIMEMLLRKGA
NAHGQASDSSSILLEAASGGNPDAVALLLEYGADANIPKNSGHLPIHVAADRGHLLALKI
LIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINKHYDDHRKSAL
YFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCE
VITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRL
KIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTGTW
Download sequence
Identical sequences ENSP00000419199 NP_001136205.2.87134 NP_001136205.2.92137 XP_016861225.1.92137 XP_016861226.1.92137 ENSP00000419199 ENSP00000374252 gi|267844887|ref|NP_001136205.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]