SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375248 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375248
Domain Number 1 Region: 65-125
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375248   Gene: ENSG00000205899   Transcript: ENST00000391429
Sequence length 235
Comment pep:known chromosome:GRCh37:17:1173853:1174754:1 gene:ENSG00000205899 transcript:ENST00000391429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARP
VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV
LRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP
PHAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS
Download sequence
Identical sequences Q7RTU4
ENSP00000375248 gi|256542291|ref|NP_001157877.1| 9606.ENSP00000375248 ENSP00000375248 NP_001157877.1.87134 NP_001157877.1.92137 ENSP00000375248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]