SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375660 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375660
Domain Number 1 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 145-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 300-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000803
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 384-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000975
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 467-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000609
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375660   Gene: ENSG00000182986   Transcript: ENST00000391781
Sequence length 509
Comment pep:known chromosome:GRCh37:19:53379425:53393592:-1 gene:ENSG00000182986 transcript:ENST00000391781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSS
TGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLT
SSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHR
IIHTGEKPYKCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRSHT
GEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGKTFARNSVLVIHKAVHTAEKP
YKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRIHTGEKPYKCK
VCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDK
VYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSL
RSLLAEHQKIPFGDNCFKCNEYSKPSSIN
Download sequence
Identical sequences A2RRD8
ENSP00000375660 ENSP00000473091 9606.ENSP00000332877 ENSP00000375660 ENSP00000473091 ENSP00000375660 gi|61676195|ref|NP_997216.2| NP_997216.2.87134 NP_997216.2.92137 XP_006723122.1.92137 XP_016881882.1.92137 XP_016881883.1.92137 XP_016881884.1.92137 XP_016881885.1.92137 XP_016881886.1.92137 XP_016881887.1.92137 XP_016881888.1.92137 XP_016881889.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]