SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375662 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375662
Domain Number 1 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 67-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000078
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375662   Gene: ENSG00000167562   Transcript: ENST00000391785
Sequence length 531
Comment pep:known chromosome:GRCh37:19:53073526:53090427:1 gene:ENSG00000167562 transcript:ENST00000391785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLHVGQDGLELPTSGDPPASASQSAGITGVSHRTQPPCFEGLTSKDLVREEKTRKRKR
KAKESGMALLQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDTSSKCM
MKMFSSTGQGNTEVVHTGTLQIHASHHIGDTCFQEIEKDIHDFVFQWQENETNGHEALMT
KTKKLMSSTERHDQRHAGNKPIKNELGSSFHSHLPEVHIFHPEGKIGNQVEKAINDAFSV
SASQRISCRPKTRISNKYRNNFLQSSLLTQKREVHTREKSFQRNESGKAFNGSSLLKKHQ
IIHLGDKQYKCDVCGKDFHQKRYLACHRCHTGENPYTCNECGKTFSHNSALLVHKAIHTG
EKPYKCNECGKVFNQQSNLARHHRVHTGEKPYKCEECDKVFSRKSHLERHRRIHTGEKPY
KCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMHKVIHTGEKRYKCNE
CGKVFNHKSNLACHRRLHTGEKPYKCNECGKVFNRKSNLERHHRLHTGKKS
Download sequence
Identical sequences Q9NV72
ENSP00000301093 ENSP00000444339 NP_001166126.1.87134 NP_001166126.1.92137 XP_011525394.1.92137 gi|289547640|ref|NP_001166126.1| ENSP00000301093 ENSP00000444339 ENSP00000375662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]