SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375820 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375820
Domain Number 1 Region: 545-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 601-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 441-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 323-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000037
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 7 Region: 379-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000937
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 271-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000376
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375820   Gene: ENSG00000159915   Transcript: ENST00000391958
Sequence length 670
Comment pep:known chromosome:GRCh37:19:44764076:44779470:1 gene:ENSG00000159915 transcript:ENST00000391958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFQEMVTFKDVAVVFTREELGLLDLAQRKLYQDVMLENFRNLLSVGYQPFKLDVILQL
GKEDKLRMMETEIQGDGCSGHKNQNEIDTLQEVRLRFLSYEDLICWQIWEQFTSKLTSNQ
DLIINLQGKRSKLLKQGDSPCQVWTGESSQVSEDENYVIKLQGESSNSIKNQELPLRTTW
DFWRKMYLREPQNYQSRCQQIDVKNKLCKCDHCVRQRIAHQHDDHGVHKREKAFSHNNCG
KDCVKESSQHSIIQSGEQTSDENGKGLSVGSNLELHQQLHLRDKPHVNVEYGKGIGYSSG
LPRHQCFHIGEKCYRNGDSGEGFSQGSHLQPHQRVSTGENLYRCQVYARSSNQNSCLPSH
ELTHPGEKLCTCGRCGKGFHHSLDFDIHCVDSAGERACKCDVYDKGFSQTSQLQAHQRGH
SRDKTYKWEVSDRIFNRNSGLHQRVHTGEKPYKCEVCDKGFSKASNLQAHQRIHTGEKPY
KCDVCDKNFSRNSHLQAHQRVHTGEKPYKCDTCGKDFSQISHLQAHQRVHKGEKPYKCET
CGKGFSQSSHLQDHQQVHTGENPYKCDVCGKGFSWSSHLQAHQRVHTGEKPYKCEECRKG
FIWNSYLHVHQRIHTGEKPYKCGMCGKSFSQTSHLQAHQRVHTGEKPYKCFVCGKGFSKS
SLSSDSSESP
Download sequence
Identical sequences A6NK53
ENSP00000375820 gi|333033765|ref|NP_001193934.1| gi|333033817|ref|NP_861421.2| ENSP00000375820 NP_001193934.1.87134 NP_001193934.1.92137 NP_861421.2.87134 NP_861421.2.92137 9606.ENSP00000375820 ENSP00000375820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]