SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000375988 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375988
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 139-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 460-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375988   Gene: ENSG00000120784   Transcript: ENST00000392144
Sequence length 519
Comment pep:known chromosome:GRCh37:19:38123389:38146289:-1 gene:ENSG00000120784 transcript:ENST00000392144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARDLVMFRDVAVDFSQEEWECLNSYQRNLYRDVILENYSNLVSLAGCSISKPDVITLLE
QGKEPWMVVRDEKRRWTLDLESRYDTKKLFQGKDIYEMNLSQWKVMERIKSCGLEEQESP
HEVCFRQVTKTTSEKMPTYRKLTSLPLYQKSHNREKPYECGECGKAFRVRQQLTFHQRIH
TGEKPYECKECGKAFRQCAHLSRHQRIHTSDKLYECKKCGKIFTCGSDLRVHQRIHIGEK
PYECKECGKAFRVRGQLNLHQRIHTGEKPYECKECGKAFRQYAHLTRHQRLNIAEKCYEC
KECGQAFLCSTGLRLHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHTGEKPYDCKECG
KTFSRGYHLTLHQRIHTGEKPYECKECQKFFRRYSELISHQGIHIGEKPYECKECGKAFR
LFSQLTQHQSIHFGEKPFKCKECEKTFRLLSQLTQHQSIHTGEKPYDCKECGKAFRLHSS
LIQHQRIHSGEKPYKCKECKKAFRQHSHLTYHQRIHNVT
Download sequence
Identical sequences A0A2I2YQQ8 D3Y2A0 Q9Y2G7
ENSP00000343581 ENSP00000375988 ENSP00000422930 ENSGGOP00000016245 NP_001307595.1.87134 NP_001307595.1.92137 NP_001307596.1.87134 NP_001307596.1.92137 NP_001307597.1.87134 NP_001307597.1.92137 NP_001307598.1.87134 NP_001307598.1.92137 NP_055713.1.87134 NP_055713.1.92137 XP_018871434.1.27298 XP_018871435.1.27298 ENSP00000375988 gi|7662408|ref|NP_055713.1| ENSGGOP00000016245 9606.ENSP00000343581 ENSP00000343581 ENSP00000375988 ENSP00000422930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]