SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375994 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375994
Domain Number 1 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 2 Region: 422-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 478-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 31-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 519-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 605-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000054
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 578-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000428
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375994   Gene: ENSG00000181666   Transcript: ENST00000392153
Sequence length 659
Comment pep:known chromosome:GRCh37:19:37825568:37855353:1 gene:ENSG00000181666 transcript:ENST00000392153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVNHTVSTMLPTCMVHRQTMSCSGAGGITAFVAFRDVAVYFTQEEWRLLSPAQRTLHRE
VMLETYNHLVSLEIPSSKPKLIAQLERGEAPWREERKCPLDLCPESKPEIQLSPSCPLIF
SSQQALSQHVWLSHLSQLFSSLWAGNPLHLGKHYPEDQKQQQDPFCFSGKAEWIQEGEDS
RLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVS
GFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIKNPRTHSGGKP
YVCRECGRGFTWKSNLITHQRTHSGEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCK
ECGQSFSLKSNLITHQRAHTGEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICRECEQ
GFSQKSHLIRHLRTHTGEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVCLECGQCFSL
KSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVCAECGRGFNDKSTL
ISHQRTHSGEKPFMCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRA
HAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG
Download sequence
Identical sequences P10072
NP_861451.1.87134 NP_861451.1.92137 ENSP00000315505 gi|32401441|ref|NP_861451.1| 9606.ENSP00000315505 ENSP00000375994 ENSP00000315505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]