SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376712 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376712
Domain Number 1 Region: 259-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-64
Family Nuclear receptor ligand-binding domain 0.000000000728
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376712   Gene: ENSG00000012504   Transcript: ENST00000392986
Sequence length 486
Comment pep:known chromosome:GRCh37:12:100867694:100957281:1 gene:ENSG00000012504 transcript:ENST00000392986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEG
RDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences Q96RI1
ENSP00000376712 NP_001193922.1.87134 NP_001193922.1.92137 ENSP00000447149 gi|332801067|ref|NP_001193922.1| ENSP00000447149 HR4469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]