SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377570 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377570
Domain Number 1 Region: 336-407
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.01e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 96-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000209
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSP00000377570
Domain Number - Region: 208-324
Classification Level Classification E-value
Superfamily Prefoldin 0.00602
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377570   Gene: ENSG00000131737   Transcript: ENST00000394001
Sequence length 436
Comment pep:known chromosome:GRCh37:17:39533902:39538655:-1 gene:ENSG00000131737 transcript:ENST00000394001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSS
RPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLE
RDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLAS
DDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEV
NTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVEINRREVEQWFATQTEELNKQV
VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYSSQLSQVQSLI
TNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS
GNSCGPCGTSQKGCCN
Download sequence
Identical sequences O76011
NP_066293.2.87134 NP_066293.2.92137 gi|14917119|ref|NP_066293.2| 9606.ENSP00000251648 ENSP00000377570 ENSP00000377570 ENSP00000377570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]