SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378531 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378531
Domain Number 1 Region: 374-635
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-56
Family Nuclear receptor ligand-binding domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 302-379
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378531   Gene: ENSG00000119508   Transcript: ENST00000395097
Sequence length 637
Comment pep:known chromosome:GRCh37:9:102584137:102627333:1 gene:ENSG00000119508 transcript:ENST00000395097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITA
TATTSLPSISTFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQ
QQHQQPSIPPASSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAP
GPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAA
AAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGE
GTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRF
QKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS
TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLL
IESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNL
DIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVE
LRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences NP_775292.1.87134 NP_775292.1.92137 ENSP00000333122 ENSP00000482027 ENSP00000378531 9606.ENSP00000333122 ENSP00000333122 gi|27894361|ref|NP_775292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]