SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379699 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379699
Domain Number 1 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 7 Region: 504-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 185-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000216
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379699   Gene: ENSG00000198346   Transcript: ENST00000396421
Sequence length 617
Comment pep:known chromosome:GRCh37:19:53971000:54006950:1 gene:ENSG00000198346 transcript:ENST00000396421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSS
TAQGNREVIHTGTLQRHESHHTGDFRFQEIDKDIHNLEFQWQEDERNSHEAPMTEIKKLT
GSADRYDQRHAGNKPIKDQLGSSFHSHLPELHMFQTQGKIGNQVEKSINDASSISTSQRI
SCRPKTHISNNYGNNFRNSSLLTQKQEVHMREKSFQCNESGKAFNYSSLLRKHQIIHLGE
KQYKCDVCGKVFNRKRNLVCHRRCHTGEKPYRCNECGKTFSQTYSLTCHRRLHTGEKPYK
CEECDKAFSFKSNLKRHRRIHAGEKPYKCNECGKTFSQTSSLTCHRRLHTGEKPFKCNEC
GKTFSRKSSLTCHHRLHTGEKPYKCNECGKTFSQELTLKCHRRLHTGEKPYKCNECGKVF
NKKANLARHHRLHSGEKPYKCTECVKTFSRNSALVIHKAIHIGEKRYKCNECGKTFSRIS
ALVIHTAIHTGEKPYKCNECGKGFNRKTHLACHHRLHTGEKPYKCNECGKVFNRKTHLAH
HHRLHTGDKPYKCNECGKVFNQKAHLARHHRLHTGEKPYKCNECGKVFNQKANLARHHRL
HTGEKPYKFNECGKAFN
Download sequence
Identical sequences Q6ZN06
9606.ENSP00000379684 NP_001004301.2.87134 NP_001004301.2.92137 gi|108796666|ref|NP_001004301.2| ENSP00000379684 ENSP00000379699 ENSP00000379684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]