SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385099 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385099
Domain Number 1 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000321
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385099   Gene: ENSG00000180884   Transcript: ENST00000404801
Sequence length 632
Comment pep:known chromosome:GRCh37:19:35447258:35454953:-1 gene:ENSG00000180884 transcript:ENST00000404801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRDPAQGCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCHGTEGKDLPSEHNVSVEGVAQDR
SPEATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVCEAYVKGSEFSANLPRKQV
QQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCREGGKDFVATAGFLQCEVTPSDGEPHEA
TEGVVDFHIALRHNKCCESGDAFNNKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLNNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHIRERSMENVLLPCSQH
TPEISSENRPYQGAVNYKLKLVHPSTHPGEVP
Download sequence
Identical sequences Q3KQV3
ENSP00000385099 gi|145309330|ref|NP_787068.3| ENSP00000385099 9606.ENSP00000385099 NP_787068.3.87134 NP_787068.3.92137 ENSP00000385099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]