SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385163 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385163
Domain Number 1 Region: 252-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 420-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 198-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 364-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 15-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 476-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000624
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 155-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000907
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385163   Gene: ENSG00000204920   Transcript: ENST00000407951
Sequence length 549
Comment pep:putative chromosome:GRCh37:19:44488346:44502005:1 gene:ENSG00000204920 transcript:ENST00000407951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKRSKVLVFCSKIMEEAVTFKDVAVVFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGH
QPFHQDTCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAK
DLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSISDVPIFDLPQQL
YSEEKSYTCDECGKSICYISALHVHQRVHVGEKLFMCDVCGKEFSQSSHLQTHQRVHTGE
KPFKCEQCGKGFSRRSALNVHRKLHTGEKPYICEACGKAFIHDSQLKEHKRIHTGEKPFK
CDICGKTFYFRSRLKSHSMVHTGEKPFRCDTCDKSFHQRSALNRHCMVHTGEKPYRCEQC
GKGFIGRLDFYKHQVVHTGEKPYNCKECGKSFRWSSCLLNHQRVHSGEKSFKCEECGKGF
YTNSQLSSHQRSHSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRAS
SILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRRYKRRLNLDI
LLSLFLNDT
Download sequence
Identical sequences XP_011525580.1.92137 XP_011525581.1.92137 XP_016882737.1.92137 ENSP00000385163 ENSP00000385163 ENSP00000385163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]