SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385523 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385523
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-82
Family Nuclear receptor ligand-binding domain 0.000000000124
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385523   Gene: ENSG00000186951   Transcript: ENST00000407236
Sequence length 468
Comment pep:known chromosome:GRCh37:22:46547787:46639652:1 gene:ENSG00000186951 transcript:ENST00000407236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences A0A2I2Z0P2 F1D8S4 Q07869
ENSGGOP00000011448 ENSP00000262735 ENSP00000385246 ENSP00000385523 gi|50348666|ref|NP_001001928.1| gi|7549811|ref|NP_005027.2| 9606.ENSP00000262735 ENSP00000385523 NP_001001928.1.87134 NP_001001928.1.92137 NP_005027.2.87134 NP_005027.2.92137 XP_004063700.1.27298 XP_005261712.1.92137 XP_005261713.1.92137 XP_006724332.1.92137 XP_006724333.1.92137 XP_011528541.1.92137 XP_011528542.1.92137 XP_011528543.1.92137 XP_011528544.1.92137 XP_011528545.1.92137 XP_018874163.1.27298 XP_018874164.1.27298 XP_018874165.1.27298 ENSGGOP00000011448 ENSP00000262735 ENSP00000379322 ENSP00000385246 ENSP00000385523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]