SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388311 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388311
Domain Number 1 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 755-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 699-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 812-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 867-924
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 12 Region: 913-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 13 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 466-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000344
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 15 Region: 186-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000876
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 16 Region: 270-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000146
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 17 Region: 550-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000984
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388311   Gene: ENSG00000213799   Transcript: ENST00000458035
Sequence length 970
Comment pep:known chromosome:GRCh37:19:53837002:53858122:1 gene:ENSG00000213799 transcript:ENST00000458035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSS
TAQGNTEVIHTGTLQRHERHHIGDFCFQEMEKDIHDFEFQWKEDERNSHEAPMTEIKQLT
GSTNRHDQRHAGNKPIKDQLGSSFHSHLPELHMFQTEGKIGNQVEKSINSASLVSTSQRI
SCRPKTHISKNYGNNFLNSSLLTQKQEVHMREKSFQCNESGKAFNYSSVLRKHQIIHLGA
KQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYK
CSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEEC
DKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTF
SQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTS
SLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTR
HCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRI
HNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGE
KPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYK
CNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVC
DKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTF
RHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQA
HLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLAR
HHRIHTGKKH
Download sequence
Identical sequences Q96IR2
gi|210031219|ref|NP_612383.1| ENSP00000388311 ENSP00000470005 9606.ENSP00000388311 ENSP00000388311 ENSP00000388311 ENSP00000470005 NP_001308451.1.87134 NP_001308451.1.92137 NP_001308452.1.87134 NP_001308452.1.92137 NP_001308453.1.87134 NP_001308453.1.92137 NP_612383.1.87134 NP_612383.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]