SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389722 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389722
Domain Number 1 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 196-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000646
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000023
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 351-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000412
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389722   Gene: ENSG00000161298   Transcript: ENST00000423582
Sequence length 550
Comment pep:putative chromosome:GRCh37:19:37095719:37118894:1 gene:ENSG00000161298 transcript:ENST00000423582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHMAKPDMIRKLE
QGEELWTQRIFPSYSYLEEDGKTEDVLVKFKEYQDRHSRPLIFINHKKLIKERSNIYGKT
FTLGKNRISKTILCEYKPDGKVLKNISELVIRNISPIKEKFGDSTGWEKSLLNTKHEKIH
PAVNLHKQTERVLSGKQELIQHQKVQAPEQPFDHNECEKSFLMKGMLFTHTRAHRGERTF
EYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPVFIMPQRPQTEEKPFHCPY
CGNNFRRKSYLIEHQRIHTGEKPYVCNQCGKAFRQKTALTLHEKTHIEGKPFICIDCGKS
FRQKATLTRHHKTHTGEKAYECPQCGSAFRKKSYLIDHQRTHTGEKPYQCNECGKAFIQK
TTLTVHQRTHTGEKPYICNECGKSFCQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILT
VHHRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECKQCGKFFSCKSNLIVHQK
THKVETTGIQ
Download sequence
Identical sequences Q96SR6
9606.ENSP00000292928 ENSP00000292928 gi|55769570|ref|NP_116214.2| ENSP00000292928 ENSP00000389722 NP_116214.2.87134 NP_116214.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]