SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392593 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392593
Domain Number 1 Region: 17-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-28
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 563-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 259-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392593   Gene: ENSG00000145908   Transcript: ENST00000418587
Sequence length 620
Comment pep:known chromosome:GRCh37:5:150273954:150284545:-1 gene:ENSG00000145908 transcript:ENST00000418587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAETSSSGLLEEQKMMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHL
VSMGYPVSKPDVISKLEQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGT
VSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKY
NPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQ
SEPNSNLEKIHNGVIPFDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQL
IVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQ
RVHTGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHT
GEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKP
YECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICT
ECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGK
AFIQKSQLTVHQRIHTVVKS
Download sequence
Identical sequences ENSP00000397178 NP_001166302.1.87134 NP_001166302.1.92137 ENSP00000392593 ENSP00000397178 9606.ENSP00000397178 gi|290542336|ref|NP_001166302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]