SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393163 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393163
Domain Number 1 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 537-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 599-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000289
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 229-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000321
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393163   Gene: ENSG00000221994   Transcript: ENST00000442455
Sequence length 657
Comment pep:known chromosome:GRCh37:X:47917571:47931001:-1 gene:ENSG00000221994 transcript:ENST00000442455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIESQEPVTFEDVAVDFTQEEWQQLNPAQKTLHRDVMLETYNHLVSVGCSGIKPDVIFKL
EHGKDPWIIESELSRWIYPDRVKGLESSQQIISGELLFQREILERAPKDNSLYSVLKIWH
IDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDS
CENSLKSNSDLLNYNRSYARKNPTKRFRCGRPPKYNASCSVPEKEGFIHTGMEPYGDSQC
EKVLSHKQAHVQYKKFQAREKPNVCSMCGKAFIKKSQLIIHQRIHTGEKPYVCGDCRKAF
SEKSHLIVHQRIHTGEKPYECTKYGRAFSRKSPFTVHQRVHTGEKPYECFECPKAFSQKS
HLIIHQRVHTREKPFECSECRKAFCEMSHLFIHQITHTGKKPYECTECGKTFPRKTQLII
HQRTHTGEKPYKCGECGKTFCQQSHLIGHQRIHTGEKPYVCTDCGKAFSQKSHLTGHQRL
HTGEKPYMCTECGKSFSQKSPLIIHQRIHTGEKPYQCGECGKTFSQKSLLIIHLRVHTGE
KPYECTECGRAFSLKSHLILHQRGHTGEKPYECSECGKAFCGKSPLIIHQKTHPREKTPE
CAESGMTFFWKSQMITYQRRHTGEKPSRCSDCGKAFCQHVYFTGHQNPYRKDTLYIC
Download sequence
Identical sequences Q2M218
gi|170016085|ref|NP_001032824.2| 9606.ENSP00000380162 ENSP00000386393 ENSP00000471800 ENSP00000393163 ENSP00000386393 ENSP00000393163 NP_001032824.2.87134 NP_001032824.2.92137 NP_001269130.1.87134 NP_001269130.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]