SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393260 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393260
Domain Number 1 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 10-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 408-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 558-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSP00000393260
Domain Number - Region: 208-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00531
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393260   Gene: ENSG00000147789   Transcript: ENST00000446747
Sequence length 697
Comment pep:putative chromosome:GRCh37:8:146052944:146068605:1 gene:ENSG00000147789 transcript:ENST00000446747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLGCWCVSFQEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVF
KPELISRLEQGEEPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVV
RISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTKDAPQ
GCKELGSSGLDCQPLESQGESAEGMSQRCEECGKGIRATSDIALHWEINTQKISRCQECQ
KKLSDCLQGKHTNNCHGEKPYECAECGKVFRLCSQLNQHQRIHTGEKPFKCTECGKAFRL
SSKLIQHQRIHTGEKPYRCEECGKAFGQSSSLIHHQRIHTGERPYGCRECGKAFSQQSQL
VRHQRTHTGERPYPCKECGKAFSQSSTLAQHQRMHTGEKAQILKASDSPSLVAHQRIHAV
EKPFKCDECGKAFRWISRLSQHQLIHTGEKPYKCNKCTKAFGCSSRLIRHQRTHTGEKPF
KCDECGKGFVQGSHLIQHQRIHTGEKPYVCNDCGKAFSQSSSLIYHQRIHKGEKPYECLQ
CGKAFSMSTQLTIHQRVHTGERPYKCNECGKAFSQNSTLFQHQIIHAGVKPYECSECGKA
FSRSSYLIEHQRIHTRAQWFYEYGNALEGSTFVSRKKVNTIKKLHQCEDCEKIFRWRSHL
IIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG
Download sequence
Identical sequences ENSP00000393260 NP_001269724.1.87134 NP_001269724.1.92137 XP_011515594.1.92137 ENSP00000393260 ENSP00000393260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]