SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395733 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395733
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000194
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 396-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000291
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395733   Gene: ENSG00000237440   Transcript: ENST00000427401
Sequence length 536
Comment pep:known chromosome:GRCh37:19:20726833:20748541:-1 gene:ENSG00000237440 transcript:ENST00000427401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYRNLVFLGIVVSKPDLITCLEQGK
KPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESV
DECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGK
AFNQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCEDCGKAFSR
FSYLTAHKIIHSGEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSIL
TAHKIIHSGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSLTTHK
IIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFKYSSSLTTHKIIHT
GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKP
YKCERCGKAFKRSFILTRHKRIHTGEKPYKCEECGKGFKCPSTLTTHKVIHTGEKL
Download sequence
Identical sequences O75373
gi|226530355|ref|NP_001152765.1| ENSP00000395733 ENSP00000458968 ENSP00000395733 ENSP00000458968 NP_001152765.1.87134 NP_001152765.1.92137 ENSP00000395733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]