SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398689 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398689
Domain Number 1 Region: 305-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000641
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398689   Gene: ENSG00000130751   Transcript: ENST00000439365
Sequence length 590
Comment pep:known chromosome:GRCh37:19:47538587:47549016:1 gene:ENSG00000130751 transcript:ENST00000439365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKVPPSS
LVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELPL
HGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLDK
GQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL
PASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGSEDSGD
EDPSSHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPG
TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Download sequence
Identical sequences Q99742
NP_002508.2.87134 NP_002508.2.92137 NYSGRC-22027482 gi|22027482|ref|NP_002508.2| ENSP00000405290 ENSP00000469142 9606.ENSP00000253050 ENSP00000405290 ENSP00000469142 ENSP00000398689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]