SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401131 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401131
Domain Number 1 Region: 221-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-40
Family SPRY domain 0.00024
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000306
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401131   Gene: ENSG00000227171   Transcript: ENST00000442378
Sequence length 420
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_COX:30027939:30033522:-1 gene:ENSG00000227171 transcript:ENST00000442378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES
Download sequence
Identical sequences Q96QB5 Q9H2S5
gi|297206763|ref|NP_079512.2| ENSP00000244360 ENSP00000393560 ENSP00000395696 ENSP00000398512 ENSP00000407291 9606.ENSP00000244360 9606.ENSP00000393560 9606.ENSP00000395696 9606.ENSP00000398512 9606.ENSP00000407291 ENSP00000244360 ENSP00000393560 ENSP00000395696 ENSP00000398512 ENSP00000407291 NP_079512.2.87134 NP_079512.2.92137 ENSP00000365942 ENSP00000401131 ENSP00000447055 ENSP00000447277 ENSP00000447398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]