SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403835 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403835
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 478-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-22
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 534-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 218-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403835   Gene: ENSG00000125846   Transcript: ENST00000434018
Sequence length 657
Comment pep:known chromosome:GRCh37:20:18269173:18295923:1 gene:ENSG00000125846 transcript:ENST00000434018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHMAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGK
ETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNI
QPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSS
RNGLRGVELEASPAQSGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHS
GEKPYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKP
YMCSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCS
DCGLGFSDRSNLISHQRTHSGEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGH
SFSQNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQ
QSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGL
IRHKRKHSREKPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCRECGQGFLQKSHLTLHQ
MTHTGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYSL
Download sequence
Identical sequences ENSP00000400897 XP_016883530.1.92137 XP_016883531.1.92137 ENSP00000403835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]